Product Browser

Last updated: 2017/7/16
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CREB3 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00010488-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CREB3 protein.
  • Immunogen:
  • CREB3 (AAH09402.1, 1 a.a. ~ 371 a.a) full-length human protein.
  • Sequence:
  • MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAIYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CREB3 expression in transfected 293T cell line (H00010488-T02) by CREB3 MaxPab polyclonal antibody.

    Lane 1: CREB3 transfected lysate(41.40 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western Blot analysis of CREB3 recombinant protein (H00010488-P01) by CREB3 purified MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • Proximity Ligation Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • In situ Proximity Ligation Assay (Cell)
  • <em>In situ</em> Proximity Ligation Assay (Cell)
  • enlarge
  • Gene Information
  • Gene Name:
  • CREB3
  • Gene Alias:
  • LUMAN,LZIP,MGC15333,MGC19782
  • Gene Description:
  • cAMP responsive element binding protein 3
  • Gene Summary:
  • This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-responsive element, an octameric palindrome. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. An additional transcript variant has been identified, but its biological validity has not been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021348,basic leucine zipper protein,cyclic AMP response element (CRE)-binding protein/activating transcription factor 1,transcription factor LZIP-alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook