Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Biomarker

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MAD2L2 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00010459-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human MAD2L2 protein.
  • Immunogen:
  • MAD2L2 (AAH15244.1, 1 a.a. ~ 211 a.a) full-length human protein.
  • Sequence:
  • MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of MAD2L2 expression in transfected 293T cell line (H00010459-T02) by MAD2L2 MaxPab polyclonal antibody.

    Lane 1: MAD2L2 transfected lysate(23.21 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • MAD2L2
  • Gene Alias:
  • MAD2B,REV7
  • Gene Description:
  • MAD2 mitotic arrest deficient-like 2 (yeast)
  • Gene Summary:
  • The protein encoded by this gene is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. The encoded protein, which is similar to MAD2L1, is capable of interacting with ADAM9, ADAM15, REV1, and REV3 proteins. [provided by RefSeq
  • Other Designations:
  • MAD2 (mitotic arrest deficient, yeast, homolog)-like 2,MAD2 homolog,OTTHUMP00000002273,OTTHUMP00000002275,mitotic arrest deficient homolog-like 2
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook