FAM3C monoclonal antibody (M05), clone 3A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
FAM3C monoclonal antibody (M05), clone 3A3. Western Blot analysis of FAM3C expression in A-431(Cat # L015V1 ).
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAM3C is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (48.07 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant FAM3C.
Immunogen
FAM3C (AAH46932, 25 a.a. ~ 227 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.07 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FAM3C monoclonal antibody (M05), clone 3A3. Western Blot analysis of FAM3C expression in A-431(Cat # L015V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAM3C is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — FAM3C
Entrez GeneID
10447GeneBank Accession#
BC046932Protein Accession#
AAH46932Gene Name
FAM3C
Gene Alias
GS3786, ILEI
Gene Description
family with sequence similarity 3, member C
Omim ID
608618Gene Ontology
HyperlinkGene Summary
This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq
Other Designations
interleukin-like EMT inducer|predicted osteoblast protein
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com