CACNG3 monoclonal antibody (M01), clone 3E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CACNG3.
Immunogen
CACNG3 (NP_006530, 199 a.a. ~ 297 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
IYIEKHQQLRAKSHSEFLKKSTFARLPPYRYRFRRRSSSRSTEPRSRDLSPISKGFHTIPSTDISMFTLSRDPSKITMGTLLNSDRDHAFLQFHNSTPK
Host
Mouse
Reactivity
Human, Rat
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CACNG3 monoclonal antibody (M01), clone 3E4 Western Blot analysis of CACNG3 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
CACNG3 monoclonal antibody (M01), clone 3E4. Western Blot analysis of CACNG3 expression in PC-12(Cat # L012V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CACNG3 expression in transfected 293T cell line by CACNG3 monoclonal antibody (M01), clone 3E4.
Lane 1: CACNG3 transfected lysate(35.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CACNG3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — CACNG3
Entrez GeneID
10368GeneBank Accession#
NM_006539Protein Accession#
NP_006530Gene Name
CACNG3
Gene Alias
Cacng2
Gene Description
calcium channel, voltage-dependent, gamma subunit 3
Omim ID
606403Gene Ontology
HyperlinkGene Summary
L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. It is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This protein is similar to the mouse stargazin protein, mutations in which have been associated with absence seizures, also known as petit-mal or spike-wave seizures. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP20 family. This gene is a candidate gene for a familial infantile convulsive disorder with paroxysomal choreoathetosis. [provided by RefSeq
Other Designations
neuronal voltage-gated calcium channel gamma-3 subunit|voltage-dependent calcium channel gamma-3 subunit|voltage-gated calcium channel gamma subunit
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com