LILRB2 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human LILRB2 full-length ORF (AAH41708.1) recombinant protein without tag.
This product is belong to Proteoliposome (PL).Sequence
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRRV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
21.2
Form
Liquid
Preparation Method
in vitro wheat germ expression system with proprietary liposome technology
Purification
None
Recommend Usage
Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage Buffer
25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Antibody Production
-
Gene Info — LILRB2
Entrez GeneID
10288GeneBank Accession#
BC041708.1Protein Accession#
AAH41708.1Gene Name
LILRB2
Gene Alias
CD85D, ILT4, LILRA6, LIR-2, LIR2, MIR-10, MIR10
Gene Description
leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2
Omim ID
604815Gene Ontology
HyperlinkGene Summary
This gene is a member of the leukocyte immunoglobulin-like receptor (LIR) family, which is found in a gene cluster at chromosomal region 19q13.4. The encoded protein belongs to the subfamily B class of LIR receptors which contain two or four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The receptor is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Ig-like transcript 4|OTTHUMP00000067358|OTTHUMP00000067463|eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6|immunoglobulin-like transcript 4|leukocyte immunoglobulin-like receptor 2|leukocyte immunoglobulin-like receptor subfa
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com