YAF2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
YAF2 MaxPab polyclonal antibody. Western Blot analysis of YAF2 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of YAF2 expression in transfected 293T cell line (H00010138-T01) by YAF2 MaxPab polyclonal antibody.
Lane 1: YAF2 transfected lysate(19.8 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human YAF2 protein.
Immunogen
YAF2 (NP_005739.2, 1 a.a. ~ 180 a.a) full-length human protein.
Sequence
MGDKKSPTRPKRQPKPSSDEGYWDCSVCTFRNSAEAFKCMMCDVRKGTSTRKPRPVSQLVAQQVTQQFVPPTQSKKEKKDKVEKEKSEKETTSKKNSHKKTRPRLKNVDRSSAQHLEVTVGDLTVIITDFKEKTKSPPASSAASADQHSQSGSSSDNTERGMSRSSSPRGEASSLNGESH
Host
Mouse
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
YAF2 MaxPab polyclonal antibody. Western Blot analysis of YAF2 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of YAF2 expression in transfected 293T cell line (H00010138-T01) by YAF2 MaxPab polyclonal antibody.
Lane 1: YAF2 transfected lysate(19.8 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — YAF2
Entrez GeneID
10138GeneBank Accession#
NM_005748.3Protein Accession#
NP_005739.2Gene Name
YAF2
Gene Alias
MGC41856
Gene Description
YY1 associated factor 2
Omim ID
607534Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene interacts with YY1, a zinc finger protein involved in negative regulation of muscle-restricted genes. This gene product itself contains a single N-terminal C2-X10-C2 zinc finger, and in contrast to YY1, is up-regulated during myogenic differentiation. It also facilitates proteolytic cleavage of YY1 by the calcium- activated protease, m-calpain, suggesting a mechanism by which this protein antagonizes the negative effect of YY1. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com