FGF19 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human FGF19 protein.
Immunogen
FGF19 (NP_005108.1, 1 a.a. ~ 216 a.a) full-length human protein.
Sequence
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (50); Rat (52)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FGF19 expression in transfected 293T cell line (H00009965-T03) by FGF19 MaxPab polyclonal antibody.
Lane 1: FGF19 transfected lysate(24 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of FGF19 transfected lysate using anti-FGF19 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGF19 purified MaxPab mouse polyclonal antibody (B02P) (H00009965-B02P). -
Gene Info — FGF19
Entrez GeneID
9965GeneBank Accession#
NM_005117Protein Accession#
NP_005108.1Gene Name
FGF19
Gene Alias
-
Gene Description
fibroblast growth factor 19
Omim ID
603891Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com