FGF19 monoclonal antibody (M01), clone 4C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant FGF19.
Immunogen
FGF19 (AAH17664, 1 a.a. ~ 216 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (50); Rat (52)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (49.5 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FGF19 expression in transfected 293T cell line by FGF19 monoclonal antibody (M01), clone 4C4.
Lane 1: FGF19 transfected lysate (Predicted MW: 24 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — FGF19
Entrez GeneID
9965GeneBank Accession#
BC017664Protein Accession#
AAH17664Gene Name
FGF19
Gene Alias
-
Gene Description
fibroblast growth factor 19
Omim ID
603891Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes including embryonic development cell growth, morphogenesis, tissue repair, tumor growth and invasion. This growth factor is a high affinity, heparin dependent ligand for FGFR4. Expression of this gene was detected only in fetal but not adult brain tissue. Synergistic interaction of the chick homolog and Wnt-8c has been shown to be required for initiation of inner ear development. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Publication Reference
-
Fibroblast Growth Factor Binding Protein 3 (FGFBP3) impacts carbohydrate and lipid metabolism.
Tassi E, Garman KA, Schmidt MO, Ma X, Kabbara KW, Uren A, Tomita Y, Goetz R, Mohammadi M, Wilcox CS, Riegel AT, Carlstrom M, Wellstein A.
Scientific Reports 2018 Oct; 8(1):15973.
Application:WB-Re, Recombinant protein.
-
FGF15/19 protein levels in the portal blood do not reflect changes in the ileal FGF15/19 or hepatic CYP7A1 mRNA levels.
Shang Q, Guo GL, Honda A, Saumoy M, Salen G, Xu G.
Journal of Lipid Research 2013 Oct; 54(10):2606.
Application:ELISA, Rabbit, Plasma.
-
Fibroblast Growth Factor Binding Protein 3 (FGFBP3) impacts carbohydrate and lipid metabolism.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com