GINS1 purified MaxPab rabbit polyclonal antibody (D02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
GINS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GINS1 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of GINS1 expression in transfected 293T cell line (H00009837-T01) by GINS1 MaxPab polyclonal antibody.
Lane 1: GINS1 transfected lysate(21.67 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GINS1 protein.
Immunogen
GINS1 (AAH12542.1, 1 a.a. ~ 196 a.a) full-length human protein.
Sequence
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
GINS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GINS1 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of GINS1 expression in transfected 293T cell line (H00009837-T01) by GINS1 MaxPab polyclonal antibody.
Lane 1: GINS1 transfected lysate(21.67 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GINS1
Entrez GeneID
9837GeneBank Accession#
BC012542.1Protein Accession#
AAH12542.1Gene Name
GINS1
Gene Alias
KIAA0186, PSF1
Gene Description
GINS complex subunit 1 (Psf1 homolog)
Omim ID
610608Gene Ontology
HyperlinkGene Summary
The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]).[supplied by OMIM
Other Designations
DNA replication complex GINS protein PSF1|OTTHUMP00000030496|partner of sld five-1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com