MLL4 monoclonal antibody (M01), clone 1F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MLL4 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.23 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant MLL4.
Immunogen
MLL4 (NP_055542, 813 a.a. ~ 904 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KVAASMPLSPGGQMEEVAGAVKQISDRGPVRSEDESVEAKRERPSGPESPVQGPRIKHVCRHAAVALGQARAMVPEDVPRLSALPLRDRQDL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.23 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged MLL4 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — MLL4
Entrez GeneID
9757GeneBank Accession#
NM_014727Protein Accession#
NP_055542Gene Name
MLL4
Gene Alias
HRX2, KIAA0304, MLL2, TRX2, WBP7
Gene Description
myeloid/lymphoid or mixed-lineage leukemia 4
Omim ID
606834Gene Ontology
HyperlinkGene Summary
This gene encodes a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Two alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene, however, the full length nature of the shorter transcript is not known. [provided by RefSeq
Other Designations
WW domain binding protein 7|mixed lineage leukemia gene homolog 2|trithorax homologue 2
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com