MAD2L1BP (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human MAD2L1BP partial ORF ( NP_055443.1, 171 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LLAPYSVDQSLSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHKLTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.18
Interspecies Antigen Sequence
Mouse (76); Rat (79)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — MAD2L1BP
Entrez GeneID
9587GeneBank Accession#
NM_014628Protein Accession#
NP_055443.1Gene Name
MAD2L1BP
Gene Alias
CMT2, KIAA0110, MGC11282, RP1-261G23.6
Gene Description
MAD2L1 binding protein
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was identified as a binding protein of the MAD2 mitotic arrest deficient-like 1 (MAD2/MAD2L1). MAD2 is a key component of the spindle checkpoint that delays the onset of anaphase until all the kinetochores are attached to the spindle. This protein may interact with the spindle checkpoint and coordinate cell cycle events in late mitosis. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000016496|caught by MAD2 protein
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com