Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL4L1 (Human) Recombinant Protein (P01)

  • Catalog # : H00009560-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL4L1 full-length ORF ( AAI48785.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.07
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009560-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9560
  • Gene Name:
  • CCL4L1
  • Gene Alias:
  • AT744.2,CCL4L,LAG-1,LAG1,SCYA4L
  • Gene Description:
  • chemokine (C-C motif) ligand 4-like 1
  • Gene Summary:
  • This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more centromeric gene. [provided by RefSeq
  • Other Designations:
  • lymphocyte activation gene 1,macrophage inflammatory protein-1b2,small inducible cytokine 4-like,small inducible cytokine A4-like, chemokine (C-C motif) ligand 4-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook