CCL4L1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CCL4L1 full-length ORF ( AAI48785.1, 1 a.a. - 92 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKLCVTVLSLLVLVAAFCSLALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.07
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CCL4L1
Entrez GeneID
9560GeneBank Accession#
BC148784Protein Accession#
AAI48785.1Gene Name
CCL4L1
Gene Alias
AT744.2, CCL4L, LAG-1, LAG1, SCYA4L
Gene Description
chemokine (C-C motif) ligand 4-like 1
Omim ID
603782Gene Ontology
HyperlinkGene Summary
This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more centromeric gene. [provided by RefSeq
Other Designations
lymphocyte activation gene 1|macrophage inflammatory protein-1b2|small inducible cytokine 4-like|small inducible cytokine A4-like, chemokine (C-C motif) ligand 4-like
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com