Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTGES monoclonal antibody (M04A), clone 2B9

  • Catalog # : H00009536-M04A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant PTGES.
  • Immunogen:
  • PTGES (AAH08280.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9536
  • Gene Name:
  • PTGES
  • Gene Alias:
  • MGC10317,MGST-IV,MGST1-L1,MGST1L1,MPGES,PGES,PIG12,PP102,PP1294,TP53I12,mPGES-1
  • Gene Description:
  • prostaglandin E synthase
  • Gene Summary:
  • The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq
  • Other Designations:
  • MGST1-like 1,OTTHUMP00000022345,glutathione S-transferase 1-like 1,microsomal glutathione S-transferase 1-like 1,microsomal prostaglandin E synthase-1,p53-induced apoptosis protein 12,p53-induced gene 12,tumor protein p53 inducible protein 12
  • RSS
  • YouTube
  • Linkedin
  • Facebook