PTGES MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human PTGES protein.
Immunogen
PTGES (NP_004869.1, 1 a.a. ~ 152 a.a) full-length human protein.
Sequence
MPAHSLVMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (79); Rat (79)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
PTGES MaxPab rabbit polyclonal antibody. Western Blot analysis of PTGES expression in mouse spleen.Western Blot (Tissue lysate)
PTGES MaxPab rabbit polyclonal antibody. Western Blot analysis of PTGES expression in human liver.Western Blot (Cell lysate)
PTGES MaxPab rabbit polyclonal antibody. Western Blot analysis of PTGES expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of PTGES expression in transfected 293T cell line (H00009536-T02) by PTGES MaxPab polyclonal antibody.
Lane 1: PTGES transfected lysate(17.1 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of PTGES transfected lysate using anti-PTGES MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with PTGES purified MaxPab mouse polyclonal antibody (B01P) (H00009536-B01P). -
Gene Info — PTGES
Entrez GeneID
9536GeneBank Accession#
NM_004878.3Protein Accession#
NP_004869.1Gene Name
PTGES
Gene Alias
MGC10317, MGST-IV, MGST1-L1, MGST1L1, MPGES, PGES, PIG12, PP102, PP1294, TP53I12, mPGES-1
Gene Description
prostaglandin E synthase
Omim ID
605172Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a glutathione-dependent prostaglandin E synthase. The expression of this gene has been shown to be induced by proinflammatory cytokine interleukin 1 beta (IL1B). Its expression can also be induced by tumor suppressor protein TP53, and may be involved in TP53 induced apoptosis. Knockout studies in mice suggest that this gene may contribute to the pathogenesis of collagen-induced arthritis and mediate acute pain during inflammatory responses. [provided by RefSeq
Other Designations
MGST1-like 1|OTTHUMP00000022345|glutathione S-transferase 1-like 1|microsomal glutathione S-transferase 1-like 1|microsomal prostaglandin E synthase-1|p53-induced apoptosis protein 12|p53-induced gene 12|tumor protein p53 inducible protein 12
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com