Product Browser

Last updated: 2017/2/19
  • Related Product Showcase
  • By Research Area

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AKAP7 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00009465-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human AKAP7 protein.
  • Immunogen:
  • AKAP7 (NP_619539.1, 1 a.a. ~ 104 a.a) full-length human protein.
  • Sequence:
  • MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AKAP7 expression in transfected 293T cell line (H00009465-T02) by AKAP7 MaxPab polyclonal antibody.

    Lane 1: AKAP7 transfected lysate(11.50 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9465
  • Gene Name:
  • AKAP7
  • Gene Alias:
  • AKAP18
  • Gene Description:
  • A kinase (PRKA) anchor protein 7
  • Gene Summary:
  • This gene encodes a member of the A-kinase anchoring protein (AKAP) family, a group of functionally related proteins that bind to a regulatory subunit (RII) of cAMP-dependent protein kinase A (PKA) and target the enzyme to specific subcellular compartments. AKAPs have a common RII-binding domain, but contain different targeting motifs responsible for directing PKA to distinct intracellular locations. Three alternatively spliced transcript variants encoding different isoforms have been described. Additional variants exist, but their full-length natures have not been determined. [provided by RefSeq
  • Other Designations:
  • A-kinase anchor protein 7,A-kinase anchor protein 7 isoform alpha,A-kinase anchor protein 7, isoform alpha,A-kinase anchor protein 9 kDa,A-kinase anchor protein, 18-kD,A-kinase anchoring protein 18,OTTHUMP00000017200,OTTHUMP00000017201,OTTHUMP00000017202,
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook