Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

QKI purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00009444-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human QKI protein.
  • Immunogen:
  • QKI (NP_996735, 1 a.a. ~ 319 a.a) full-length human protein.
  • Sequence:
  • MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGMAFPTKG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of QKI expression in transfected 293T cell line (H00009444-T01) by QKI MaxPab polyclonal antibody.

    Lane 1: QKI transfected lysate(35.09 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 9444
  • Gene Name:
  • QKI
  • Gene Alias:
  • DKFZp586I0923,Hqk,QK,QK1,QK3
  • Gene Description:
  • quaking homolog, KH domain RNA binding (mouse)
  • Gene Summary:
  • QKI belongs to a family of RNA-binding proteins that have an HNRNPK (MIM 600712) homology (KH) domain embedded in a 200-amino acid region called the GSG domain. Other members of this family include SAM68 (KHDRBS1; MIM 602489) and SF1 (MIM 601516) (Chen and Richard, 1998 [PubMed 9671495]). QKI proteins regulate RNA splicing, export of target RNAs from the nucleus, translation of proteins, and RNA stability (Lauriat et al., 2008 [PubMed 17918747]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000017581,OTTHUMP00000017582,OTTHUMP00000017583,RNA binding protein HQK,homolog of mouse quaking QKI (KH domain RNA binding protein),quaking homolog, KH domain RNA binding
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook