QKI purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of QKI expression in transfected 293T cell line (H00009444-T01) by QKI MaxPab polyclonal antibody.
Lane 1: QKI transfected lysate(35.09 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human QKI protein.
Immunogen
QKI (NP_996735, 1 a.a. ~ 319 a.a) full-length human protein.
Sequence
MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGMAFPTKG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of QKI expression in transfected 293T cell line (H00009444-T01) by QKI MaxPab polyclonal antibody.
Lane 1: QKI transfected lysate(35.09 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — QKI
Entrez GeneID
9444GeneBank Accession#
NM_206853Protein Accession#
NP_996735Gene Name
QKI
Gene Alias
DKFZp586I0923, Hqk, QK, QK1, QK3
Gene Description
quaking homolog, KH domain RNA binding (mouse)
Omim ID
609590Gene Ontology
HyperlinkGene Summary
QKI belongs to a family of RNA-binding proteins that have an HNRNPK (MIM 600712) homology (KH) domain embedded in a 200-amino acid region called the GSG domain. Other members of this family include SAM68 (KHDRBS1; MIM 602489) and SF1 (MIM 601516) (Chen and Richard, 1998 [PubMed 9671495]). QKI proteins regulate RNA splicing, export of target RNAs from the nucleus, translation of proteins, and RNA stability (Lauriat et al., 2008 [PubMed 17918747]).[supplied by OMIM
Other Designations
OTTHUMP00000017581|OTTHUMP00000017582|OTTHUMP00000017583|RNA binding protein HQK|homolog of mouse quaking QKI (KH domain RNA binding protein)|quaking homolog, KH domain RNA binding
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com