PSCD1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human PSCD1 protein.
Immunogen
PSCD1 (NP_004753.1, 1 a.a. ~ 398 a.a) full-length human protein.
Sequence
MEEDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERKNMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNGVFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAPTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (96); Rat (98)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CYTH1 MaxPab polyclonal antibody. Western Blot analysis of CYTH1 expression in NIH/3T3.Western Blot (Cell lysate)
PSCD1 MaxPab polyclonal antibody. Western Blot analysis of PSCD1 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of CYTH1 expression in transfected 293T cell line (H00009267-T01) by CYTH1 MaxPab polyclonal antibody.
Lane 1: PSCD1 transfected lysate(43.78 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CYTH1
Entrez GeneID
9267GeneBank Accession#
NM_004762.2Protein Accession#
NP_004753.1Gene Name
CYTH1
Gene Alias
B2-1, CYTOHESIN-1, D17S811E, FLJ34050, FLJ41900, PSCD1, SEC7
Gene Description
cytohesin 1
Omim ID
182115Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This gene is highly expressed in natural killer and peripheral T cells, and regulates the adhesiveness of integrins at the plasma membrane of lymphocytes. The encoded protein is 83% homologous to that of CYTH2. [provided by RefSeq
Other Designations
OTTHUMP00000196778|cytoadhesin 1|homolog of secretory protein SEC7|pleckstrin homology, Sec7 and coiled-coil domains 1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com