Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL32 (Human) Recombinant Protein (P02)

  • Catalog # : H00009235-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL32 full-length ORF ( NP_001012649.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00009235-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 9235
  • Gene Name:
  • IL32
  • Gene Alias:
  • IL-32alpha,IL-32beta,IL-32delta,IL-32gamma,NK4,TAIF,TAIFa,TAIFb,TAIFc,TAIFd
  • Gene Description:
  • interleukin 32
  • Gene Summary:
  • This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq
  • Other Designations:
  • natural killer cell transcript 4,natural killer cells protein 4,tumor necrosis factor alpha-inducing factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook