Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TMSB10 monoclonal antibody (M02), clone 2E3

  • Catalog # : H00009168-M02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant TMSB10.
  • Immunogen:
  • TMSB10 (AAH16025, 1 a.a. ~ 44 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00009168-M02
    Western Blot detection against Immunogen (30.58 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged TMSB10 is approximately 0.3ng/ml as a capture antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 9168
  • Gene Name:
  • TMSB10
  • Gene Alias:
  • MIG12,TB10
  • Gene Description:
  • thymosin beta 10
  • Other Designations:
  • migration-inducing gene 12,migration-inducing protein 12,thymosin, beta 10
  • RSS
  • YouTube
  • Linkedin
  • Facebook