NMI monoclonal antibody (M04), clone 9E8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NMI.
Immunogen
NMI (AAH01268, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (64); Rat (67)
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NMI monoclonal antibody (M04), clone 9E8 Western Blot analysis of NMI expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to NMI on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NMI is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — NMI
Entrez GeneID
9111GeneBank Accession#
BC001268Protein Accession#
AAH01268Gene Name
NMI
Gene Alias
-
Gene Description
N-myc (and STAT) interactor
Omim ID
603525Gene Ontology
HyperlinkGene Summary
NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq
Other Designations
N-myc and STAT interactor|N-myc interactor|N-myc-interactor
-
Interactome
-
Disease
-
Publication Reference
-
Nmi interacts with Hsp105β and enhances the Hsp105β-mediated Hsp70 expression.
Saito Y, Yukawa A, Matozaki M, Mikami H, Yamagami T, Yamagishi N, Kuga T, Hatayama T, Nakayama Y.
Experimental Cell Research 2014 Sep; 327(1):163.
Application:IF, WB-Tr, Human, HeLa cells.
-
Nmi interacts with Hsp105β and enhances the Hsp105β-mediated Hsp70 expression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com