NMI purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human NMI protein.
Immunogen
NMI (AAH21987.1, 1 a.a. ~ 307 a.a) full-length human protein.
Sequence
MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLRKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (64); Rat (67)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
NMI MaxPab rabbit polyclonal antibody. Western Blot analysis of NMI expression in human liver.Western Blot (Tissue lysate)
NMI MaxPab rabbit polyclonal antibody. Western Blot analysis of NMI expression in human spleen.Western Blot (Cell lysate)
NMI MaxPab rabbit polyclonal antibody. Western Blot analysis of NMI expression in A-431.Western Blot (Cell lysate)
NMI MaxPab rabbit polyclonal antibody. Western Blot analysis of NMI expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of NMI expression in transfected 293T cell line (H00009111-T02) by NMI MaxPab polyclonal antibody.
Lane 1: NMI transfected lysate(35.10 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to NMI on HeLa cell. [antibody concentration 30 ug/ml] -
Gene Info — NMI
Entrez GeneID
9111GeneBank Accession#
BC021987.2Protein Accession#
AAH21987.1Gene Name
NMI
Gene Alias
-
Gene Description
N-myc (and STAT) interactor
Omim ID
603525Gene Ontology
HyperlinkGene Summary
NMYC interactor (NMI) encodes a protein that interacts with NMYC and CMYC (two members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. The NMI protein also interacts with all STATs except STAT2 and augments STAT-mediated transcription in response to cytokines IL2 and IFN-gamma. The NMI mRNA has low expression levels in all human fetal and adult tissues tested except brain and has high expression in cancer cell line-myeloid leukemias. [provided by RefSeq
Other Designations
N-myc and STAT interactor|N-myc interactor|N-myc-interactor
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com