SLC7A7 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
SLC7A7 MaxPab polyclonal antibody. Western Blot analysis of SLC7A7 expression in rat brain.
Western Blot (Transfected lysate)
Western Blot analysis of SLC7A7 expression in transfected 293T cell line (H00009056-T01) by SLC7A7 MaxPab polyclonal antibody.
Lane1:SLC7A7 transfected lysate(56.21 KDa).
Lane2:Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human SLC7A7 protein.
Immunogen
SLC7A7 (AAH03062.1, 1 a.a. ~ 511 a.a) full-length human protein.
Sequence
MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFGLSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFANYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVAYYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICMIHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFFPIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSVAAEMDLEDGGEMPKQRDPKSN
Host
Mouse
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
SLC7A7 MaxPab polyclonal antibody. Western Blot analysis of SLC7A7 expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of SLC7A7 expression in transfected 293T cell line (H00009056-T01) by SLC7A7 MaxPab polyclonal antibody.
Lane1:SLC7A7 transfected lysate(56.21 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — SLC7A7
Entrez GeneID
9056GeneBank Accession#
BC003062.2Protein Accession#
AAH03062.1Gene Name
SLC7A7
Gene Alias
LAT3, LPI, MOP-2, Y+LAT1, y+LAT-1
Gene Description
solute carrier family 7 (cationic amino acid transporter, y+ system), member 7
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is the light subunit of a cationic amino acid transporter. This sodium-independent transporter is formed when the light subunit encoded by this gene dimerizes with the heavy subunit transporter protein SLC3A2. This transporter is found in epithelial cell membranes where it transfers cationic and large neutral amino acids from the cell to the extracellular space. Defects in this gene are a cause of lysinuric protein intolerance (LPI). Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000164491|OTTHUMP00000164492|OTTHUMP00000164494|monocyte amino acid permease 2|solute carrier family 7 member 7|y(+)L-type amino acid transporter 1
-
Interactome
-
Disease
-
Publication Reference
-
Function of SLC7A7 in T-Cell Acute Lymphoblastic Leukemia.
Ji X, Yang X, Wang N, Kang M, Wang Y, Rong L, Fang Y, Xue Y.
Cellular Physiology and Biochemistry 2018 Jul; 48(2):731.
Application：WB-Tr, Human, Jurkat cells.
-
Arginine transport in human monocytic leukemia THP-1 cells during macrophage differentiation.
Barilli A, Rotoli BM, Visigalli R, Bussolati O, Gazzola GC, Dall'asta V.
Journal of Leukocyte Biology 2011 Aug; 90(2):293.
Application：WB-Ce, WB-Tr, Human, THP-1 cells.
-
Function of SLC7A7 in T-Cell Acute Lymphoblastic Leukemia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com