WASL monoclonal antibody (M04), clone 5F4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
WASL monoclonal antibody (M04), clone 5F4 Western Blot analysis of WASL expression in IMR-32 ( Cat # L008V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to WASL on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.8 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to WASL on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (35.42 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant WASL.
Immunogen
WASL (NP_003932, 97 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NFVYNSPRGYFHTFAGDTCQVALNFANEEEAKKFRKAVTDLLGRRQRKSEKRRDPPNGPNLPMATVDIKNPEITTNRFYGPQVNNISH
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.42 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
WASL monoclonal antibody (M04), clone 5F4 Western Blot analysis of WASL expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to WASL on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 0.8 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to WASL on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — WASL
Entrez GeneID
8976GeneBank Accession#
NM_003941Protein Accession#
NP_003932Gene Name
WASL
Gene Alias
DKFZp779G0847, MGC48327, N-WASP, NWASP
Gene Description
Wiskott-Aldrich syndrome-like
Omim ID
605056Gene Ontology
HyperlinkGene Summary
The Wiskott-Aldrich syndrome (WAS) family of proteins share similar domain structure, and are involved in transduction of signals from receptors on the cell surface to the actin cytoskeleton. The presence of a number of different motifs suggests that they are regulated by a number of different stimuli, and interact with multiple proteins. Recent studies have demonstrated that these proteins, directly or indirectly, associate with the small GTPase, Cdc42, known to regulate formation of actin filaments, and the cytoskeletal organizing complex, Arp2/3. The WASL gene product is a homolog of WAS protein, however, unlike the latter, it is ubiquitously expressed and shows highest expression in neural tissues. It has been shown to bind Cdc42 directly, and induce formation of long actin microspikes. [provided by RefSeq
Other Designations
Wiskott-Aldrich syndrome gene-like|Wiskott-Aldrich syndrome gene-like protein|neural Wiskott-Aldrich syndrome protein
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com