AP1S2 monoclonal antibody (M01), clone 3B9-G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AP1S2 is approximately 3ng/ml as a capture antibody.
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant AP1S2.
Immunogen
AP1S2 (AAH01117, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (100)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AP1S2 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — AP1S2
Entrez GeneID
8905GeneBank Accession#
BC001117Protein Accession#
AAH01117Gene Name
AP1S2
Gene Alias
DC22, MGC:1902, MRX59, SIGMA1B
Gene Description
adaptor-related protein complex 1, sigma 2 subunit
Gene Ontology
HyperlinkGene Summary
Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as the small subunit of this complex and is a member of the adaptin protein family. Transcript variants utilizing alternative polyadenylation signals exist for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000022979|adaptor-related protein complex 1 sigma 2 subunit|clathrin adaptor complex AP1 sigma 1B subunit|clathrin assembly protein complex 1 sigma-1B small chain|clathrin-associated/assembly/adaptor protein small 1-like|golgi adaptor HA1/AP1 ada
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com