PRPF4B monoclonal antibody (M01), clone 3E10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRPF4B is 1 ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to PRPF4B on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.62 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant PRPF4B.
Immunogen
PRPF4B (NP_003904.2, 898 a.a. ~ 1005 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (95)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.62 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged PRPF4B is 1 ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to PRPF4B on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — PRPF4B
Entrez GeneID
8899GeneBank Accession#
NM_003913Protein Accession#
NP_003904.2Gene Name
PRPF4B
Gene Alias
KIAA0536, PR4H, PRP4, PRP4H, PRP4K, dJ1013A10.1
Gene Description
PRP4 pre-mRNA processing factor 4 homolog B (yeast)
Omim ID
602338Gene Ontology
HyperlinkGene Summary
Pre-mRNA splicing occurs in two sequential transesterification steps, and the protein encoded by this gene is thought to be involved in pre-mRNA splicing and in signal transduction. This protein belongs to a kinase family that includes serine/arginine-rich protein-specific kinases and cyclin-dependent kinases (CDKs). This protein is regarded as a CDK-like kinase (Clk) with homology to mitogen-activated protein kinases (MAPKs). [provided by RefSeq
Other Designations
OTTHUMP00000039176|dJ1013A10.1 (PRP4 protein kinase homolog)|protein-serine/threonine kinase|serine/threonine-protein kinase PRP4 homolog|serine/threonine-protein kinase PRP4K
-
Interactome
-
Disease
-
Publication Reference
-
Loss of cyclin-dependent kinase-like 2 predicts poor prognosis in gastric cancer, and its overexpression suppresses cells growth and invasion.
Fang CL, Uen YH, Chen HK, Hseu YC, Lin CC, Hung ST, Sun DP, Lin KY.
Cancer Medicine 2018 May; [Epub].
Application：IHC-P, WB-Ce, WB-Ti, WB-Tr, Human, Gastric tissues, Hs738.St/Int, AGS, TMC-1, HGC-27, 23132/87, AGS-CDKL2, HGC-27-CDKL2 cells.
-
Loss of cyclin-dependent kinase-like 2 predicts poor prognosis in gastric cancer, and its overexpression suppresses cells growth and invasion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com