Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ARHGEF7 polyclonal antibody (A01)

  • Catalog # : H00008874-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ARHGEF7.
  • Immunogen:
  • ARHGEF7 (NP_663788, 102 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • SSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008874-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8874
  • Gene Name:
  • ARHGEF7
  • Gene Alias:
  • BETA-PIX,COOL1,DKFZp686C12170,DKFZp761K1021,KIAA0142,KIAA0412,Nbla10314,P50,P50BP,P85,P85COOL1,P85SPR,PAK3,PIXB
  • Gene Description:
  • Rho guanine nucleotide exchange factor (GEF) 7
  • Gene Summary:
  • Rho GTPases play a fundamental role in numerous cellular processes triggered by extracellular stimuli that work through G protein coupled receptors. The encoded protein belongs to a family of cytoplasmic proteins that activate the Ras-like family of Rho proteins by exchanging bound GDP for GTP. It forms a complex with the small GTP binding protein Rac1 and recruits Rac1 to membrane ruffles and to focal adhesions. This protein can induce membrane ruffling. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000178804,PAK-interacting exchange factor beta,SH3 domain-containing proline-rich protein,guanine nucleotide exchange factor 7,rho guanine nucleotide exchange factor 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook