Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CDK5R1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008851-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CDK5R1 partial ORF ( AAH20580, 208 a.a. - 307 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • CRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008851-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8851
  • Gene Name:
  • CDK5R1
  • Gene Alias:
  • CDK5P35,CDK5R,MGC33831,NCK5A,p23,p25,p35,p35nck5a
  • Gene Description:
  • cyclin-dependent kinase 5, regulatory subunit 1 (p35)
  • Gene Summary:
  • The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. [provided by RefSeq
  • Other Designations:
  • CDK5 activator 1,TPKII regulatory subunit,cyclin-dependent kinase 5 activator 1,cyclin-dependent kinase 5, regulatory subunit 1,neuronal CDK5 activator,regulatory partner for CDK5 kinase,tau protein kinase II 23kDa subunit
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook