BANF1 monoclonal antibody (M07), clone M2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant BANF1.
Immunogen
BANF1 (AAH05942, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (96); Rat (96)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in PC-12.Western Blot (Cell lysate)
BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in Raw 264.7.Western Blot (Cell lysate)
BANF1 monoclonal antibody (M07), clone M2. Western Blot analysis of BANF1 expression in Jurkat.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged BANF1 is approximately 10ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to BANF1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — BANF1
Entrez GeneID
8815GeneBank Accession#
BC005942Protein Accession#
AAH05942Gene Name
BANF1
Gene Alias
BAF, BCRP1, D14S1460, MGC111161
Gene Description
barrier to autointegration factor 1
Omim ID
603811Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene was first identified by its ability to protect retroviruses from intramolecular integration and therefore promote intermolecular integration into the host cell genome. The protein forms a homodimer which localizes to both the nucleus and cytoplasm and is specifically associated with chromosomes during mitosis. This protein binds to double stranded DNA in a non-specific manner and also binds to LEM-domain containing proteins of the nuclear envelope. This protein is thought to facilitate nuclear reassembly by binding with both DNA and inner nuclear membrane proteins and thereby recruit chromatin to the nuclear periphery. Alternative splicing results in multiple transcript variants encoding the same protein
Other Designations
-
-
Interactome
-
Publication Reference
-
Inhibition of PP2A activity by H2O2 during mitosis disrupts nuclear envelope reassembly and alters nuclear shape.
Ahn JH, Cho MG, Sohn S, Lee JH.
Experimental & Molecular Medicine 2019 Jun; 51(6):64.
Application:IF, WB-Tr, Human, HeLa cells.
-
Functional Disruption of the Moloney Murine Leukemia Virus Preintegration Complex by Vaccinia-related Kinases.
Suzuki Y, Ogawa K, Koyanagi Y, Suzuki Y.
The Journal of Biological Chemistry 2010 Jul; 285(31):24032.
Application:IP, KA, WB, Mouse, NIH/3T3 cells, Recombinant proteins.
-
Inhibition of PP2A activity by H2O2 during mitosis disrupts nuclear envelope reassembly and alters nuclear shape.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com