Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRADD (Human) Recombinant Protein (P02)

  • Catalog # : H00008738-P02
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CRADD full-length ORF ( AAH17042, 1 a.a. - 199 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHIQEINAQTTGLRKTMLLLDILPSRGPKAFDTFLDSLQEFPWVREKLKKAREEAMTDLPAGDRLTGIPSHILNSSPSDRQINQLAQRLGPEWEPMVPSLGLSQTDIYRCKANHPHNVQSQVVEAFIRWRQRFGKQATFQSLHNGLRAVEVDPSLLLHMLE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 47.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008738-P02
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8738
  • Gene Name:
  • CRADD
  • Gene Alias:
  • MGC9163,RAIDD
  • Gene Description:
  • CASP2 and RIPK1 domain containing adaptor with death domain
  • Gene Summary:
  • The protein encoded by this gene is a death domain (CARD/DD)-containing protein and has been shown to induce cell apoptosis. Through its CARD domain, this protein interacts with, and thus recruits, caspase 2/ICH1 to the cell death signal transduction complex that includes tumor necrosis factor receptor 1 (TNFR1A), RIPK1/RIP kinase, and numbers of other CARD domain-containing proteins. [provided by RefSeq
  • Other Designations:
  • RIP-associated ICH1/CED3-homologous protein with death domain,RIP-associated protein with a death domain,caspase and RIP adaptor with death domain,death adaptor molecule RAIDD,death domain containing protein CRADD
  • RSS
  • YouTube
  • Linkedin
  • Facebook