EIF3S1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of EIF3J expression in transfected 293T cell line (H00008669-T01) by EIF3J MaxPab polyclonal antibody.
Lane 1: EIF3S1 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human EIF3S1 protein.
Immunogen
EIF3S1 (NP_003749.2, 1 a.a. ~ 258 a.a) full-length human protein.
Sequence
MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EIF3J expression in transfected 293T cell line (H00008669-T01) by EIF3J MaxPab polyclonal antibody.
Lane 1: EIF3S1 transfected lysate(28.38 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EIF3J
Entrez GeneID
8669GeneBank Accession#
NM_003758.2Protein Accession#
NP_003749.2Gene Name
EIF3J
Gene Alias
EIF3S1, eIF3-alpha, eIF3-p35
Gene Description
eukaryotic translation initiation factor 3, subunit J
Omim ID
603910Gene Ontology
HyperlinkGene Summary
Eukaryotic initiation factor-3 (EIF3) has a molecular mass of about 600 kD and contains 13 nonidentical protein subunits, including EIF3J. EIF3 plays a central role in binding of initiator methionyl-tRNA and mRNA to the 40S ribosomal subunit to form the 40S initiation complex (Fraser et al., 2004 [PubMed 14688252]; Fraser et al., 2007 [PubMed 17588516]).[supplied by OMIM
Other Designations
eukaryotic translation initiation factor 3, subunit 1 (alpha, 35kD)|eukaryotic translation initiation factor 3, subunit 1 alpha, 35kDa
-
Interactome
-
Publication Reference
-
Analysis of the protein expression changes during taxol-induced apoptosis under translation inhibition conditions.
Pineiro D, Gonzalez VM, Salinas M, Elena Martin M.
Molecular and Cellular Biochemistry 2010 Dec; 345(1-2):131.
Application：Func, Human, HEK 293T cells.
-
Analysis of the protein expression changes during taxol-induced apoptosis under translation inhibition conditions.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com