AKR1C3 MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human AKR1C3 protein.
Immunogen
AKR1C3 (NP_003730.4, 1 a.a. ~ 323 a.a) full-length human protein.
Sequence
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (73); Rat (71)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
AKR1C3 MaxPab polyclonal antibody. Western Blot analysis of AKR1C3 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of AKR1C3 expression in transfected 293T cell line (H00008644-T02) by AKR1C3 MaxPab polyclonal antibody.
Lane 1: AKR1C3 transfected lysate(35.53 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AKR1C3
Entrez GeneID
8644GeneBank Accession#
NM_003739.4Protein Accession#
NP_003730.4Gene Name
AKR1C3
Gene Alias
DD3, DDX, HA1753, HAKRB, HAKRe, HSD17B5, KIAA0119, hluPGFS
Gene Description
aldo-keto reductase family 1, member C3 (3-alpha hydroxysteroid dehydrogenase, type II)
Omim ID
603966Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. [provided by RefSeq
Other Designations
OTTHUMP00000018996|aldo-keto reductase family 1, member C3|chlordecone reductase|dihydrodiol dehydrogenase 3|dihydrodiol dehydrogenase X|hydroxysteroid (17-beta) dehydrogenase 5|prostaglandin F synthase|trans-1,2-dihydrobenzene-1,2-diol dehydrogenase|type
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com