CDC14B purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CDC14B protein.
Immunogen
CDC14B (ENSP00000265659, 1 a.a. ~ 471 a.a) full-length human protein.
Sequence
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAILYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVHFTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLLDCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGYHQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFLVMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDDEINGVTQGDRLRALKSRRQSKTNAIPLTDGWLSQAVTFLDRLLIWLGIHKD
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (85); Rat (89)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
CDC14B MaxPab rabbit polyclonal antibody. Western Blot analysis of CDC14B expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of CDC14B expression in transfected 293T cell line (H00008555-T01) by CDC14B MaxPab polyclonal antibody.
Lane 1: CDC14B transfected lysate(54.20 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CDC14B
Entrez GeneID
8555GeneBank Accession#
ENST00000265659Protein Accession#
ENSP00000265659Gene Name
CDC14B
Gene Alias
CDC14B3, Cdc14B1, Cdc14B2, hCDC14B
Gene Description
CDC14 cell division cycle 14 homolog B (S. cerevisiae)
Omim ID
603505Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the dual specificity protein tyrosine phosphatase family. This protein is highly similar to Saccharomyces cerevisiae Cdc14, a protein tyrosine phosphatase involved in the exit of cell mitosis and initiation of DNA replication, which suggests the role in cell cycle control. This protein has been shown to interact with and dephosphorylates tumor suppressor protein p53, and is thought to regulate the function of p53. Alternative splice of this gene results in 3 transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
CDC14 homolog B|OTTHUMP00000021729|OTTHUMP00000021730|OTTHUMP00000063774
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com