Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

SMARCA5 polyclonal antibody (A01)

  • Catalog # : H00008467-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant SMARCA5.
  • Immunogen:
  • SMARCA5 (NP_003592, 59 a.a. ~ 147 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EEIFDDASPGKQKEIQEPDPTYEEKMQTDRANRFEYLLKQTELFAHFIQPAAQKTPTSPLKMKPGRPRIKKDEKQNLLSVGDYRHRRTE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00008467-A01
    Western Blot detection against Immunogen (35.9 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • SMARCA5 polyclonal antibody (A01), Lot # 051018JC01 Western Blot analysis of SMARCA5 expression in Y-79 ( Cat # L042V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 8467
  • Gene Name:
  • SMARCA5
  • Gene Alias:
  • ISWI,SNF2H,WCRF135,hISWI,hSNF2H
  • Gene Description:
  • SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 5
  • Gene Summary:
  • The protein encoded by this gene is a member of the SWI/SNF family of proteins. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The protein encoded by this gene is a component of the chromatin remodeling and spacing factor RSF, a facilitator of the transcription of class II genes by RNA polymerase II. The encoded protein is similar in sequence to the Drosophila ISWI chromatin remodeling protein. [provided by RefSeq
  • Other Designations:
  • SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a5,sucrose nonfermenting-like 5
  • RSS
  • YouTube
  • Linkedin
  • Facebook