FZD4 monoclonal antibody (M02), clone 3G7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FZD4.
Immunogen
FZD4 (NP_036325, 107 a.a. ~ 206 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGY
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FZD4 expression in transfected 293T cell line by FZD4 monoclonal antibody (M02), clone 3G7.
Lane 1: FZD4 transfected lysate (Predicted MW: 59.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FZD4 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — FZD4
Entrez GeneID
8322GeneBank Accession#
NM_012193Protein Accession#
NP_036325Gene Name
FZD4
Gene Alias
CD344, EVR1, FEVR, FZD4S, Fz-4, FzE4, GPCR, MGC34390
Gene Description
frizzled homolog 4 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence. [provided by RefSeq
Other Designations
WNT receptor frizzled-4|exudative vitreoretinopathy 1 (autosomal dominant; Criswick-Schepens syndrome)|frizzled 4
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com