Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BAP1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00008314-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BAP1 partial ORF ( AAH01596, 61 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00008314-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 8314
  • Gene Name:
  • BAP1
  • Gene Alias:
  • DKFZp686N04275,FLJ35406,FLJ37180,HUCEP-13,KIAA0272,UCHL2,hucep-6
  • Gene Description:
  • BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
  • Gene Summary:
  • The protein encoded by this gene localizes to the nucleus and it interacts with the RING finger domain of the breast cancer 1, early onset protein (BRCA1). This gene is thought to be a tumor suppressor gene that functions in the BRCA1 growth control pathway. There are multiple polyadenylation sites found in this gene. [provided by RefSeq
  • Other Designations:
  • BRCA1 associated protein-1,cerebral protein-13,cerebral protein-6,ubiquitin carboxy-terminal hydrolase
  • RSS
  • YouTube
  • Linkedin
  • Facebook