STAM purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human STAM protein.
Immunogen
STAM (AAH30586.1, 1 a.a. ~ 403 a.a) full-length human protein.
Sequence
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAYLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPGSGPTIRKPSPS
Host
Mouse
Reactivity
Human, Rat
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
STAM MaxPab polyclonal antibody. Western Blot analysis of STAM expression in rat brain.Western Blot (Transfected lysate)
Western Blot analysis of STAM expression in transfected 293T cell line (H00008027-T03) by STAM MaxPab polyclonal antibody.
Lane 1: STAM transfected lysate(45.00 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — STAM
Entrez GeneID
8027GeneBank Accession#
BC030586.2Protein Accession#
AAH30586.1Gene Name
STAM
Gene Alias
DKFZp686J2352, STAM1
Gene Description
signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
Omim ID
601899Gene Ontology
HyperlinkGene Summary
This gene was identified by the rapid tyrosine-phosphorylation of its product in response to cytokine stimulation. The encoded protein contains a SH3 domain and the immunoreceptor tyrosine-based activation motif (ITAM). This protein associates with JAK3 and JAK2 kinases via its ITAM region, and is phosphorylated by the JAK kinases upon cytokine stimulation, which suggests the function of this protein is as an adaptor molecule involved in the downstream signaling of cytokine receptors. HGS/HRS (hepatocyte grwoth factor-regulated tyrosine kinase substrate) has been found to bind and counteract the function of this protein. [provided by RefSeq
Other Designations
OTTHUMP00000019237|signal transducing adaptor molecule 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com