BRD3 monoclonal antibody (M03), clone 6C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
BRD3 monoclonal antibody (M03), clone 6C10. Western Blot analysis of BRD3 expression in human kidney.
Western Blot (Cell lysate)
BRD3 monoclonal antibody (M03), clone 6C10 Western Blot analysis of BRD3 expression in Hela S3 NE ( Cat # L013V3 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BRD3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (40.92 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant BRD3.
Immunogen
BRD3 (AAH32124, 418 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EPVEAPALPAPAAPMVSKGAESSRSSEESSSDSGSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAPPAKQAQQKKAPAKKANSTTTAGRDHFLTCGV
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (96); Rat (92)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.92 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
BRD3 monoclonal antibody (M03), clone 6C10. Western Blot analysis of BRD3 expression in human kidney.Western Blot (Cell lysate)
BRD3 monoclonal antibody (M03), clone 6C10 Western Blot analysis of BRD3 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to BRD3 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]ELISA
-
Gene Info — BRD3
Entrez GeneID
8019GeneBank Accession#
BC032124Protein Accession#
AAH32124Gene Name
BRD3
Gene Alias
FLJ23227, FLJ41328, KIAA0043, ORFX, RING3L
Gene Description
bromodomain containing 3
Omim ID
601541Gene Ontology
HyperlinkGene Summary
This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein is not known. [provided by RefSeq
Other Designations
OTTHUMP00000022724|RING3-like|bromodomain containing protein 3|bromodomain-containing 3
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com