Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HSD17B8 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00007923-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human HSD17B8 protein.
  • Immunogen:
  • HSD17B8 (NP_055049.1, 1 a.a. ~ 261 a.a) full-length human protein.
  • Sequence:
  • MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • HSD17B8 MaxPab polyclonal antibody. Western Blot analysis of HSD17B8 expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of HSD17B8 expression in transfected 293T cell line (H00007923-T02) by HSD17B8 MaxPab polyclonal antibody.

    Lane 1: HSD17B8 transfected lysate(28.71 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7923
  • Gene Name:
  • HSD17B8
  • Gene Alias:
  • D6S2245E,FABG,FABGL,H2-KE6,HKE6,KE6,RING2,SDR30C1,dJ1033B10.9
  • Gene Description:
  • hydroxysteroid (17-beta) dehydrogenase 8
  • Gene Summary:
  • In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq
  • Other Designations:
  • 17-beta-HSD 8,17-beta-hydroxysteroid dehydrogenase 8,OTTHUMP00000029153,beta-ketoacyl-[acyl-carrier-protein] reductase-like,estradiol 17 beta-dehydrogenase 8,estrogen 17-oxidoreductase,short chain dehydrogenase/reductase family 30C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook