HSD17B8 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human HSD17B8 protein.
Immunogen
HSD17B8 (NP_055049.1, 1 a.a. ~ 261 a.a) full-length human protein.
Sequence
MASQLQNRLRSALALVTGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAARCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNVGQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQKVVDKITEMIPMGHLGDPEDVADVVAFLASEDSGYITGTSVEVTGGLFM
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (87); Rat (87)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HSD17B8 MaxPab polyclonal antibody. Western Blot analysis of HSD17B8 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of HSD17B8 expression in transfected 293T cell line (H00007923-T02) by HSD17B8 MaxPab polyclonal antibody.
Lane 1: HSD17B8 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HSD17B8
Entrez GeneID
7923GeneBank Accession#
NM_014234.3Protein Accession#
NP_055049.1Gene Name
HSD17B8
Gene Alias
D6S2245E, FABG, FABGL, H2-KE6, HKE6, KE6, RING2, SDR30C1, dJ1033B10.9
Gene Description
hydroxysteroid (17-beta) dehydrogenase 8
Omim ID
601417Gene Ontology
HyperlinkGene Summary
In mice, the Ke6 protein is a 17-beta-hydroxysteroid dehydrogenase that can regulate the concentration of biologically active estrogens and androgens. It is preferentially an oxidative enzyme and inactivates estradiol, testosterone, and dihydrotestosterone. However, the enzyme has some reductive activity and can synthesize estradiol from estrone. The protein encoded by this gene is similar to Ke6 and is a member of the short-chain dehydrogenase superfamily. An alternatively spliced transcript of this gene has been detected, but the full-length nature of this variant has not been determined. [provided by RefSeq
Other Designations
17-beta-HSD 8|17-beta-hydroxysteroid dehydrogenase 8|OTTHUMP00000029153|beta-ketoacyl-[acyl-carrier-protein] reductase-like|estradiol 17 beta-dehydrogenase 8|estrogen 17-oxidoreductase|short chain dehydrogenase/reductase family 30C, member 1
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com