Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UQCRB (Human) Recombinant Protein (P01)

  • Catalog # : H00007381-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UQCRB full-length ORF ( AAH05230, 1 a.a. - 111 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRMFRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.95
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007381-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7381
  • Gene Name:
  • UQCRB
  • Gene Alias:
  • FLJ92016,FLJ97033,QCR7,QP-C,QPC,UQBC,UQBP,UQPC
  • Gene Description:
  • ubiquinol-cytochrome c reductase binding protein
  • Gene Summary:
  • This gene encodes a protein which is part of the ubiquinol-cytochrome c oxidoreductase complex which contains ten nuclear-encoded and one mitochondrial-encoded subunits. The encoded protein binds ubiquinone and participates in the transfer of electrons when ubiquinone is bound. Mutations in this gene are associated with mitochondrial complex III deficiency. A pseudogene has been described on the X chromosome. [provided by RefSeq
  • Other Designations:
  • complex III subunit 7,complex III subunit VII,ubiquinol-cytochrome c reductase complex 14 kDa protein,ubiquinone-binding protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook