UBE2D3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human UBE2D3 full-length ORF ( AAH03395, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDRDKYNRISREWTQKYAM
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41.91
Interspecies Antigen Sequence
Mouse (100); Rat (100)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — UBE2D3
Entrez GeneID
7323GeneBank Accession#
BC003395Protein Accession#
AAH03395Gene Name
UBE2D3
Gene Alias
E2(17)KB3, MGC43926, MGC5416, UBC4/5, UBCH5C
Gene Description
ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)
Omim ID
602963Gene Ontology
HyperlinkGene Summary
The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Multiple spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000161758|OTTHUMP00000161759|ubiquitin carrier protein|ubiquitin-conjugating enzyme E2-17 kDa 3|ubiquitin-conjugating enzyme E2D 3|ubiquitin-conjugating enzyme E2D 3 (homologous to yeast UBC4/5)
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com