Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBA52 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007311-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human UBA52 partial ORF ( NP_003324, 29 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007311-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7311
  • Gene Name:
  • UBA52
  • Gene Alias:
  • CEP52,HUBCEP52,MGC126879,MGC126881,MGC57125,RPL40
  • Gene Description:
  • ubiquitin A-52 residue ribosomal protein fusion product 1
  • Gene Summary:
  • Ubiquitin is a highly conserved nuclear and cytoplasmic protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein L40 at the C terminus, a C-terminal extension protein (CEP). Multiple processed pseudogenes derived from this gene are present in the genome. [provided by RefSeq
  • Other Designations:
  • 60S ribosomal protein L40,ribosomal protein L40,ubiquitin and ribosomal protein L40,ubiquitin carboxyl extension protein 52,ubiquitin-52 amino acid fusion protein,ubiquitin-CEP52
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook