TRAF3 monoclonal antibody (M01), clone 1C5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TRAF5 and TRAF3. HeLa cells were stained with anti-TRAF5 rabbit purified polyclonal 1:1200 and anti-TRAF3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blot detection against Immunogen (38.17 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TRAF3.
Immunogen
TRAF3 (NP_663777, 298 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.17 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between TRAF5 and TRAF3. HeLa cells were stained with anti-TRAF5 rabbit purified polyclonal 1:1200 and anti-TRAF3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — TRAF3
Entrez GeneID
7187GeneBank Accession#
NM_145725Protein Accession#
NP_663777Gene Name
TRAF3
Gene Alias
CAP-1, CD40bp, CRAF1, LAP1
Gene Description
TNF receptor-associated factor 3
Omim ID
601896Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported. [provided by RefSeq
Other Designations
CD40 associated protein 1|CD40 binding protein|CD40 receptor associated factor 1|LMP1 associated protein
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com