Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TPD52L1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00007164-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TPD52L1 partial ORF ( NP_001003396.1, 60 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • KERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRRK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.09
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00007164-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 7164
  • Gene Name:
  • TPD52L1
  • Gene Alias:
  • D53,MGC8556,TPD52L2,hD53
  • Gene Description:
  • tumor protein D52-like 1
  • Gene Summary:
  • This gene encodes a member of the tumor protein D52 (TPD52) family. The encoded protein contains a coiled-coil domain and may form homo- or hetero-dimer with TPD52 family members. The protein is reported to be involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed, but the full-length nature of some variants has not yet been determined. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000017133,OTTHUMP00000017135,OTTHUMP00000017136,tumor protein D52-like 2,tumor protein D53
  • RSS
  • YouTube
  • Linkedin
  • Facebook