TPD52L1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human TPD52L1 full-length ORF ( AAH02375.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAYKKTHETLSHAGQKATAAFSNVGTAISKKFGDMSYSIRHSISMPAMRRK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
41.47
Interspecies Antigen Sequence
Mouse (95); Rat (93)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — TPD52L1
Entrez GeneID
7164GeneBank Accession#
BC002375.1Protein Accession#
AAH02375.1Gene Name
TPD52L1
Gene Alias
D53, MGC8556, TPD52L2, hD53
Gene Description
tumor protein D52-like 1
Omim ID
604069Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the tumor protein D52 (TPD52) family. The encoded protein contains a coiled-coil domain and may form homo- or hetero-dimer with TPD52 family members. The protein is reported to be involved in cell proliferation and calcium signaling. It also interacts with the mitogen-activated protein kinase kinase kinase 5 (MAP3K5/ASK1) and positively regulates MAP3K5-induced apoptosis. Multiple alternatively spliced transcript variants have been observed, but the full-length nature of some variants has not yet been determined. [provided by RefSeq
Other Designations
OTTHUMP00000017133|OTTHUMP00000017135|OTTHUMP00000017136|tumor protein D52-like 2|tumor protein D53
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com