Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TMEM1 monoclonal antibody (M01), clone 5B4

  • Catalog # : H00007109-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant TMEM1.
  • Immunogen:
  • TMEM1 (NP_003265, 1162 a.a. ~ 1257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007109-M01
    Western Blot detection against Immunogen (36.3 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • TMEM1 monoclonal antibody (M01), clone 5B4. Western Blot analysis of TRAPPC10 expression in Jurkat.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody (M01), clone 5B4.

    Lane 1: TMEM1 transfected lysate(142.2 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi ( Cat # H00007109-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TMEM1 monoclonal antibody (M01), clone 5B4 (Cat # H00007109-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 7109
  • Gene Name:
  • TRAPPC10
  • Gene Alias:
  • EHOC-1,EHOC1,FLJ54223,FLJ54817,FLJ55683,GT334,MGC126777,TMEM1,TRS130,TRS30
  • Gene Description:
  • trafficking protein particle complex 10
  • Gene Summary:
  • The protein encoded by this gene is a transmembrane protein found in the cis-Golgi complex. The encoded protein is part of the multisubunit transport protein particle (TRAPP) complex and may be involved in vesicular transport from the endoplasmic reticulum to the Golgi. Mutations in this gene could be responsible for the Unverricht-Lundborg type of progressive myoclonus epilepsy, or for autoimmune polyglandular disease type 1. [provided by RefSeq
  • Other Designations:
  • TRAPP 130 kDa subunit,epilepsy holoprosencephaly candidate-1 protein,trafficking protein particle complex subunit 130,transmembrane protein 1,transport protein particle subunit TMEM1
  • RSS
  • YouTube
  • Linkedin
  • Facebook