Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

THRA polyclonal antibody (A01)

  • Catalog # : H00007067-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant THRA.
  • Immunogen:
  • THRA (AAH02728, 87 a.a. ~ 178 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEQNRERRRKEEMIRSLQQRPEPTPEEWDLIHIATEAHRST
  • Host:
  • Mouse
  • Reactivity:
  • Human, Rat
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00007067-A01
    Western Blot detection against Immunogen (36.23 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • THRA polyclonal antibody (A01). Western Blot analysis of THRA expression in PC-12.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 7067
  • Gene Name:
  • THRA
  • Gene Alias:
  • AR7,EAR7,ERB-T-1,ERBA,ERBA1,MGC000261,MGC43240,NR1A1,THRA1,THRA2,c-ERBA-1
  • Gene Description:
  • thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
  • Gene Summary:
  • The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • ERBA-related 7,OTTHUMP00000164470,avian erythroblastic leukemia viral (v-erb-a) oncogene homolog,thyroid hormone receptor alpha,thyroid hormone receptor, alpha,triiodothyronine receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook