TFAP2A monoclonal antibody (M01), clone 2G5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant TFAP2A.
Immunogen
TFAP2A (AAH17754, 99 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGLLHTHRGLPHQLSGLDPRRDYRRHEDLLHGPHALSSGLGDLSIHSLPHAIEEVPHVEDPGINIPDQTVIKKGPVSLSKSNSNAVSAIPINKDNLFGGVVNPNEVF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Rat (96)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.4 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TFAP2A expression in transfected 293T cell line by TFAP2A monoclonal antibody (M01), clone 2G5.
Lane 1: TFAP2A transfected lysate(48.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to TFAP2A on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged TFAP2A is approximately 1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of TFAP2A over-expressed 293 cell line, cotransfected with TFAP2A Validated Chimera RNAi ( Cat # H00007020-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with TFAP2A monoclonal antibody (M01), clone 2G5 (Cat # H00007020-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — TFAP2A
Entrez GeneID
7020GeneBank Accession#
BC017754Protein Accession#
AAH17754Gene Name
TFAP2A
Gene Alias
AP-2, AP-2alpha, AP2TF, BOFS, TFAP2
Gene Description
transcription factor AP-2 alpha (activating enhancer binding protein 2 alpha)
Omim ID
107580Gene Ontology
HyperlinkGene Summary
AP2-alpha is a 52-kD retinoic acid-inducible and developmentally regulated activator of transcription that binds to a consensus DNA-binding sequence CCCCAGGC in the SV40 and metallothionein (MIM 156350) promoters.[supplied by OMIM
Other Designations
OTTHUMP00000016013|OTTHUMP00000016014|activating enhancer-binding protein 2 alpha|transcription factor AP-2 alpha|transcription factor AP-2 alpha (activating enhancer-binding protein 2 alpha)
-
Interactome
-
Disease
-
Publication Reference
-
Single-Cell RNA-Seq Analysis of Retinal Development Identifies NFI Factors as Regulating Mitotic Exit and Late-Born Cell Specification.
Clark BS, Stein-O'Brien GL, Shiau F, Cannon GH, Davis-Marcisak E, Sherman T, Santiago CP, Hoang TV, Rajaii F, James-Esposito RE, Gronostajski RM, Fertig EJ, Goff LA, Blackshaw S.
Neuron 2019 Jun; 102(6):1111.
Application:IHC-Fr, Mouse, Mouse eyes.
-
Single-Cell RNA-Seq Analysis of Retinal Development Identifies NFI Factors as Regulating Mitotic Exit and Late-Born Cell Specification.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com