TFAM MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TFAM protein.
Immunogen
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (63)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TFAM MaxPab rabbit polyclonal antibody. Western Blot analysis of TFAM expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of TFAM expression in transfected 293T cell line (H00007019-T02) by TFAM MaxPab polyclonal antibody.
Lane 1: TFAM transfected lysate(29.10 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of TFAM transfected lysate using anti-TFAM MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with TFAM purified MaxPab mouse polyclonal antibody (B01P) (H00007019-B01P). -
Gene Info — TFAM
Entrez GeneID
7019GeneBank Accession#
NM_003201.1Protein Accession#
NP_003192.1Gene Name
TFAM
Gene Alias
MtTF1, TCF6, TCF6L1, TCF6L2, TCF6L3, mtTFA
Gene Description
transcription factor A, mitochondrial
Omim ID
600438Gene Ontology
HyperlinkGene Summary
This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq
Other Designations
OTTHUMP00000019633|Transcription factor 6-like 2 (mitochondrial transcription factor)|mitochondrial transcription factor A
-
Interactome
-
Disease
-
Publication Reference
-
N-cystaminylbiguanide MC001 prevents neuron cell death and alleviates motor deficits in the MPTP-model of Parkinson's disease.
Binglin Xu, Xiaoquan Wang, Zhengshuang Xu, Qinkai Li, Junmin Quan.
Neuroscience Letters 2022 Jul; 784:136751.
Application:WB-Ce, Mouse, Mouse substantia nigra.
-
The TFAM-to-mtDNA ratio defines inner-cellular nucleoid populations with distinct activity levels.
Christian Brüser, Jan Keller-Findeisen, Stefan Jakobs.
Cell Reports 2021 Nov; 37(8):110000.
Application:IF, Human, Human dermal fibroblasts.
-
COX6A2 variants cause a muscle-specific cytochrome c oxidase deficiency.
Inoue M, Uchino S, Iida A, Noguchi S, Hayashi S, Takahashi T, Fujii K, Komaki H, Takeshita E, Nonaka I, Okada Y, Yoshizawa T, Van Lommel L, Schuit F, Goto YI, Mimaki M, Nishino I.
Annals of Neurology 2019 Aug; 86(2):193.
Application:WB-Ti, Human, Human skeletal muscles.
-
Ropinirole protects against 1-methyl-4-phenyl-1, 2, 3, 6-tetrahydropyridine (MPTP)-induced neurotoxicity in mice via anti-apoptotic mechanism.
Park G, Park YJ, Yang HO, Oh MS.
Pharmacology, Biochemistry, and Behavior 2013 Jan; 104:163.
Application:WB, Mouse, Substantia nigra pars compacta.
-
Skeletal muscle growth hormone receptor signaling regulates basal, but not fasting-induced, lipid oxidation.
Vijayakumar A, Wu Y, Buffin NJ, Li X, Sun H, Gordon RE, Yakar S, LeRoith D.
PLoS One 2012 Sep; 7(9):e44777.
Application:WB, Mouse, Mouse muscle.
-
N-cystaminylbiguanide MC001 prevents neuron cell death and alleviates motor deficits in the MPTP-model of Parkinson's disease.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com