TFAM purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human TFAM protein.
Immunogen
TFAM (NP_003192.1, 1 a.a. ~ 246 a.a) full-length human protein.
Sequence
MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAEWQVYKEEISRFKEQLTPSQIMSLEKEIMDKHLKRKAMTKKKELTLLGKPKRPRSAYNVYVAERFQEAKGDSPQEKLKTVKENWKNLSDSEKELYIQHAKEDETRYHNEMKSWEEQMIEVGRKDLLRRTIKKQRKYGAEEC
Host
Rabbit
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (63)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
TFAM MaxPab rabbit polyclonal antibody. Western Blot analysis of TFAM expression in mouse liver.Western Blot (Transfected lysate)
Western Blot analysis of TFAM expression in transfected 293T cell line (H00007019-T01) by TFAM MaxPab polyclonal antibody.
Lane 1: TFAM transfected lysate(29.10 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — TFAM
Entrez GeneID
7019GeneBank Accession#
NM_003201.1Protein Accession#
NP_003192.1Gene Name
TFAM
Gene Alias
MtTF1, TCF6, TCF6L1, TCF6L2, TCF6L3, mtTFA
Gene Description
transcription factor A, mitochondrial
Omim ID
600438Gene Ontology
HyperlinkGene Summary
This gene encodes a mitochondrial transcription factor that is a key activator of mitochondrial transcription as well as a participant in mitochondrial genome replication. Studies in mice have demonstrated that this gene product is required to regulate the mitochondrial genome copy number and is essential for embryonic development. A mouse model for Kearns-Sayre syndrome was produced when expression of this gene was eliminated by targeted disruption in heart and muscle cells. [provided by RefSeq
Other Designations
OTTHUMP00000019633|Transcription factor 6-like 2 (mitochondrial transcription factor)|mitochondrial transcription factor A
-
Interactome
-
Disease
-
Publication Reference
-
Resistance training diminishes mitochondrial adaptations to subsequent endurance training in healthy untrained men.
Paulo H C Mesquita, Joshua S Godwin, Bradley A Ruple, Casey L Sexton, Mason C McIntosh, Breanna J Mueller, Shelby C Osburn, C Brooks Mobley, Cleiton A Libardi, Kaelin C Young, L Bruce Gladden, Michael D Roberts, Andreas N Kavazis.
The Journal of Physiology 2023 Sep; 601(17):3825.
Application:WB-Ti, Human, Muscle.
-
Acute and chronic effects of resistance training on skeletal muscle markers of mitochondrial remodeling in older adults.
Paulo H C Mesquita, Donald A Lamb, Hailey A Parry, Johnathon H Moore, Morgan A Smith, Christopher G Vann, Shelby C Osburn, Carlton D Fox, Bradley A Ruple, Kevin W Huggins, Andrew D Fruge, Kaelin C Young, Andreas N Kavazis, Michael D Roberts.
Physiological Reports 2020 Aug; 8(15):e14526.
Application:WB-Ti, Human, Human muscle samples.
-
Nuclear respiratory factor-1 and bioenergetics in tamoxifen-resistant breast cancer cells.
Radde BN, Ivanova MM, Mai MX,Alizadeh-Rad N, Piell K, Hoose PV, Cole MP, Muluhngwi P, Kalbfleisch TS, Rouchka EC, Hill BG, Klinge CM.
Experimental Cell Research 2016 Sep; 347(1):222.
Application:WB-Ce, Human, MCF-7 , T47D, LCC1, LCC2, LCC9 cells.
-
Evaluation of the Role of JNK1 in the Hippocampus in an Experimental Model of Familial Alzheimer's Disease.
Petrov D, Luque M, Pedrós I, Ettcheto M, Abad S, Pallàs M, Verdaguer E, Auladell C, Folch J, Camins A.
Molecular Neurobiology 2015 Nov; 53(9):6183.
Application:WB-Ti, Mouse, Mouse hippocampus.
-
Melatonin blunts the mitochondrial/NLRP3 connection and protects against radiation-induced oral mucositis.
Ortiz F, Acuna-Castroviejo D, Doerrier C, Dayoub JC, Lopez LC, Venegas C, Garcia JA, Lopez A, Volt H, Luna-Sanchez M, Escames G.
Journal of Pineal Research 2015 Jan; 58(1):34.
Application:WB-Ti, Rat, Tongues.
-
Estradiol and tamoxifen regulate NRF-1 and mitochondrial function in mouse mammary gland and uterus.
Ivanova MM, Radde BN, Son J, Mehta FF, Chung SH, Klinge CM.
Journal of Molecular Endocrinology 2013 Sep; 51(2):233.
Application:WB-Ti, Mouse, Mammary gland, Uterus.
-
Resistance training diminishes mitochondrial adaptations to subsequent endurance training in healthy untrained men.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com