TDG purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human TDG protein.
Immunogen
TDG (AAH37557.1, 1 a.a. ~ 410 a.a) full-length human protein.
Sequence
MEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPAQEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITDTFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGHHYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGSKDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNLEFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLKGIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENPCSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCGTQEQEEESHA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of TDG expression in transfected 293T cell line (H00006996-T01) by TDG MaxPab polyclonal antibody.
Lane 1: TDG transfected lysate(45.1 KDa).
Lane 2: Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to TDG on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — TDG
Entrez GeneID
6996GeneBank Accession#
BC037557.1Protein Accession#
AAH37557.1Gene Name
TDG
Gene Alias
-
Gene Description
thymine-DNA glycosylase
Omim ID
601423Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the TDG/mug DNA glycosylase family. Thymine-DNA glycosylase (TDG) removes thymine moieties from G/T mismatches by hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of DNA and the mispaired thymine. With lower activity, this enzyme also removes thymine from C/T and T/T mispairings. TDG can also remove uracil and 5-bromouracil from mispairings with guanine. This enzyme plays a central role in cellular defense against genetic mutation caused by the spontaneous deamination of 5-methylcytosine and cytosine. This gene may have a pseudogene in the p arm of chromosome 12. [provided by RefSeq
Other Designations
G/T mismatch-specific thymine DNA glycosylase
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
A Dual Network Hydrogel Sunscreen Based on Poly-γ-glutamic acid/Tannic Acid Demonstrates Excellent Anti-UV, Self-Recovery and Skin-Integration Capacities.
Wang R, Wang X, Zhan Y, Xu Z, Xu Z, Feng X, Li S, Xu H.
ACS Applied Materials & Interfaces 2019 Oct; 11(41):37502.
Application:IF, Mouse, 3T3 fibroblasts.
-
A Dual Network Hydrogel Sunscreen Based on Poly-γ-glutamic acid/Tannic Acid Demonstrates Excellent Anti-UV, Self-Recovery and Skin-Integration Capacities.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com